Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) |
Protein automated matches [190139] (19 species) not a true protein |
Species Crotalus durissus [TaxId:8732] [188410] (2 PDB entries) |
Domain d2qogb_: 2qog B: [167742] automated match to d1a2aa_ complexed with ca |
PDB Entry: 2qog (more details), 2.28 Å
SCOPe Domain Sequences for d2qogb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qogb_ a.133.1.2 (B:) automated matches {Crotalus durissus [TaxId: 8732]} hllqfnkmikfetrknaipfyafygcycgwggrgrpkdatdrccfvhdccygklakcntk wdiypyslksgyitcgkgtwceeqicecdrvaaeclrrslstykygymfypdsrcrgpse tc
Timeline for d2qogb_: