Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) |
Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein) automatically mapped to Pfam PF07475 |
Protein HPr kinase HprK C-terminal domain [64187] (3 species) |
Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries) |
Domain d2qmhj_: 2qmh J: [167733] automated match to d1kklc_ mutant |
PDB Entry: 2qmh (more details), 2.6 Å
SCOPe Domain Sequences for d2qmhj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qmhj_ c.91.1.2 (J:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql ifdvpvpkitvpfkvgrnlaiiievaamnfraksmgydatktfeknlnhliehneetd
Timeline for d2qmhj_: