SCOPe 2.06: Domain d2qmea1: 2qme A:1-177

Lineage for d2qmea1 (2qme A:1-177)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d2qmea1: 2qme A:1-177 [167723]
   Other proteins in same PDB: d2qmea2
   automated match to d2c2ha1
   complexed with gcp, gol, mg

Details for d2qmea1

PDB Entry: 2qme, 1.75 Å

PDB Description: Crystal structure of human RAC3 in complex with CRIB domain of human p21-activated kinase 1 (PAK1)

PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 3

SCOPe Domain Sequences for d2qmea1:

Sequence; same for both SEQRES and ATOM records:

>d2qmea1 c.37.1.8 (A:1-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

Timeline for d2qmea1:

• d2qmea1 first appeared in SCOPe 2.01, called d2qmea_
  
• d2qmea1 was called d2qmea_ in SCOPe 2.05
  
• d2qmea1 appears in SCOPe 2.07
  
• d2qmea1 appears in the current release, SCOPe 2.08