Lineage for d2qmbd_ (2qmb D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903773Species Turkey (Meleagris gallopavo) [TaxId:9103] [189160] (2 PDB entries)
  8. 903776Domain d2qmbd_: 2qmb D: [167722]
    automated match to d1hbrd_
    complexed with hem, oxy

Details for d2qmbd_

PDB Entry: 2qmb (more details), 2.8 Å

PDB Description: structure determination of haemoglobin from turkey(meleagris gallopavo) at 2.8 angstrom resolution
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d2qmbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmbd_ a.1.1.2 (D:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
dftpecqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d2qmbd_:

Click to download the PDB-style file with coordinates for d2qmbd_.
(The format of our PDB-style files is described here.)

Timeline for d2qmbd_: