SCOPe 2.08: Domain d2qlxa1: 2qlx A:1-106

Lineage for d2qlxa1 (2qlx A:1-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Rhizobium leguminosarum [TaxId:386] [188716] (2 PDB entries)

8. Domain d2qlxa1: 2qlx A:1-106 [167718]
   Other proteins in same PDB: d2qlxa2, d2qlxb2
   automated match to d1x8da1
   complexed with fmt, mg, rm4

Details for d2qlxa1

PDB Entry: 2qlx, 2 Å

PDB Description: crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose

PDB Compounds: (A:) L-rhamnose mutarotase

SCOPe Domain Sequences for d2qlxa1:

Sequence; same for both SEQRES and ATOM records:

>d2qlxa1 d.58.4.0 (A:1-106) automated matches {Rhizobium leguminosarum [TaxId: 386]}
mtlekhafkmqlnpgmeaeyrkrhdeiwpelvdllhqsgasdysihldretntlfgvltr
pkdhtmaslpdhpvmkkwwahmadimatnpdnspvqsdlvtlfhmp

Timeline for d2qlxa1:

• d2qlxa1 first appeared in SCOPe 2.01, called d2qlxa_
  
• d2qlxa1 appears in SCOPe 2.07