Lineage for d2qkee_ (2qke E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878824Family c.47.1.15: KaiB-like [102449] (3 proteins)
    Pfam PF07689; contains members with alternative folds
  6. 2878838Protein automated matches [190797] (3 species)
    not a true protein
  7. 2878839Species Synechococcus elongatus [TaxId:32046] [188470] (1 PDB entry)
  8. 2878844Domain d2qkee_: 2qke E: [167696]
    automated match to d1r5pb_

Details for d2qkee_

PDB Entry: 2qke (more details), 2.7 Å

PDB Description: Wild Type Crystal Structure of Full Length Circadian Clock Protein KaiB from Thermosynechococcus elongatus BP-1
PDB Compounds: (E:) Circadian clock protein kaiB

SCOPe Domain Sequences for d2qkee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkee_ c.47.1.15 (E:) automated matches {Synechococcus elongatus [TaxId: 32046]}
rktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatpt
lakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle

SCOPe Domain Coordinates for d2qkee_:

Click to download the PDB-style file with coordinates for d2qkee_.
(The format of our PDB-style files is described here.)

Timeline for d2qkee_: