Lineage for d1mmoc_ (1mmo C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639192Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 639193Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)
  8. 639221Domain d1mmoc_: 1mmo C: [16769]
    Other proteins in same PDB: d1mmod_, d1mmoe_, d1mmog_, d1mmoh_
    complexed with acy, fe

Details for d1mmoc_

PDB Entry: 1mmo (more details), 2.2 Å

PDB Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
PDB Compounds: (C:) methane monooxygenase hydrolase (beta chain)

SCOP Domain Sequences for d1mmoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmoc_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
gysadgqiramnptwrtsscnrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
dyasaidfkadrdqivkavlaglk

SCOP Domain Coordinates for d1mmoc_:

Click to download the PDB-style file with coordinates for d1mmoc_.
(The format of our PDB-style files is described here.)

Timeline for d1mmoc_: