Lineage for d1fz2d_ (1fz2 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316654Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 2316655Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 2316679Domain d1fz2d_: 1fz2 D: [16767]
    Other proteins in same PDB: d1fz2a_, d1fz2b_, d1fz2e_, d1fz2f_
    complexed with ca, fe2

Details for d1fz2d_

PDB Entry: 1fz2 (more details), 2.15 Å

PDB Description: methane monooxygenase hydroxylase, form ii mixed-valent generated by crystal soaking
PDB Compounds: (D:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz2d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlagl

SCOPe Domain Coordinates for d1fz2d_:

Click to download the PDB-style file with coordinates for d1fz2d_.
(The format of our PDB-style files is described here.)

Timeline for d1fz2d_: