Lineage for d2qi5a_ (2qi5 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 955289Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 955305Protein Human immunodeficiency virus type 1 protease [50632] (5 species)
  7. 955367Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (378 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 955640Domain d2qi5a_: 2qi5 A: [167611]
    automated match to d1kzka_
    complexed with mz7, po4

Details for d2qi5a_

PDB Entry: 2qi5 (more details), 1.85 Å

PDB Description: crystal structure of protease inhibitor, mit-2-kc08 in complex with wild type hiv-1 protease
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2qi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qi5a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d2qi5a_:

Click to download the PDB-style file with coordinates for d2qi5a_.
(The format of our PDB-style files is described here.)

Timeline for d2qi5a_: