Lineage for d1fz3d_ (1fz3 D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766739Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 766740Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)
  8. 766752Domain d1fz3d_: 1fz3 D: [16751]
    Other proteins in same PDB: d1fz3a_, d1fz3b_, d1fz3e_, d1fz3f_
    complexed with ca, fe, fmt

Details for d1fz3d_

PDB Entry: 1fz3 (more details), 2.03 Å

PDB Description: methane monooxygenase hydroxylase, form iii soak at ph 6.2 (0.1 m pipes)
PDB Compounds: (D:) methane monooxygenase component a, beta chain

SCOP Domain Sequences for d1fz3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz3d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1fz3d_:

Click to download the PDB-style file with coordinates for d1fz3d_.
(The format of our PDB-style files is described here.)

Timeline for d1fz3d_: