SCOPe 2.06: Domain d2qakb_: 2qak B:

Lineage for d2qakb_ (2qak B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (50 PDB entries)

8. Domain d2qakb_: 2qak B: [167495]
   automated match to d1ajva_
   complexed with 1un; mutant

Details for d2qakb_

PDB Entry: 2qak, 2.2 Å

PDB Description: hiv-1 pr mutant in complex with nelfinavir

PDB Compounds: (B:) protease retropepsin

SCOPe Domain Sequences for d2qakb_:

Sequence; same for both SEQRES and ATOM records:

>d2qakb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfiavrqyd
qilieicghkaigtvlvgptpvniigrnlmtqigctlnf

Timeline for d2qakb_:

• d2qakb_ first appeared in SCOPe 2.01
  
• d2qakb_ appears in SCOPe 2.05
  
• d2qakb_ appears in SCOPe 2.07
  
• d2qakb_ appears in the current release, SCOPe 2.08