SCOPe 2.08: Domain d2q89a1: 2q89 A:1-256

Lineage for d2q89a1 (2q89 A:1-256)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188303] (2 PDB entries)

8. Domain d2q89a1: 2q89 A:1-256 [167471]
   Other proteins in same PDB: d2q89a2
   automated match to d1hpbp_
   complexed with 6cs, cd

Details for d2q89a1

PDB Entry: 2q89, 2.3 Å

PDB Description: crystal structure of ehub in complex with hydroxyectoine

PDB Compounds: (A:) Putative ABC transporter amino acid-binding protein

SCOPe Domain Sequences for d2q89a1:

Sequence; same for both SEQRES and ATOM records:

>d2q89a1 c.94.1.0 (A:1-256) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
denkleelkeqgfariaianeppftavgadgkvsgaapdvareifkrlgvadvvasisey
gamipglqagrhdaitaglfmkpercaavaysqpilcdaeafalkkgnplglksykdiad
npdakigapgggteeklaleagvprdrvivvpdgqsglkmlqdgridvyslpvlsindlv
skandpnvevlapvegapvycdgaafrkgdealrdafdvelaklkesgefakiiepygfs
akaamsttreklcaak

Timeline for d2q89a1:

• d2q89a1 first appeared in SCOPe 2.01, called d2q89a_
  
• d2q89a1 appears in SCOPe 2.07