Lineage for d1fz1a_ (1fz1 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766676Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 766677Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 766682Domain d1fz1a_: 1fz1 A: [16744]
    Other proteins in same PDB: d1fz1c_, d1fz1d_, d1fz1e_, d1fz1f_

Details for d1fz1a_

PDB Entry: 1fz1 (more details), 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii oxidized
PDB Compounds: (A:) methane monooxygenase component a, alpha chain

SCOP Domain Sequences for d1fz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz1a_ a.25.1.2 (A:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
aqphvrgdklwtlddikrlncvfknpvkafn

SCOP Domain Coordinates for d1fz1a_:

Click to download the PDB-style file with coordinates for d1fz1a_.
(The format of our PDB-style files is described here.)

Timeline for d1fz1a_: