Lineage for d1fz1a_ (1fz1 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2566Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 2567Species Methylococcus capsulatus [TaxId:414] [47255] (10 PDB entries)
  8. 2572Domain d1fz1a_: 1fz1 A: [16744]
    Other proteins in same PDB: d1fz1e_, d1fz1f_

Details for d1fz1a_

PDB Entry: 1fz1 (more details), 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii oxidized
PDB Compounds: (A:)

SCOP Domain Sequences for d1fz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz1a_ a.25.1.2 (A:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
aqphvrgdklwtlddikrlncvfknpvkafn

SCOP Domain Coordinates for d1fz1a_:

Click to download the PDB-style file with coordinates for d1fz1a_.
(The format of our PDB-style files is described here.)

Timeline for d1fz1a_: