Lineage for d1mtyd_ (1mty D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279915Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 279957Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 279958Species Methylococcus capsulatus [TaxId:414] [88790] (15 PDB entries)
  8. 279959Domain d1mtyd_: 1mty D: [16742]
    Other proteins in same PDB: d1mtyb_, d1mtyc_, d1mtyg_, d1mtyh_

Details for d1mtyd_

PDB Entry: 1mty (more details), 1.7 Å

PDB Description: methane monooxygenase hydroxylase from methylococcus capsulatus (bath)
PDB Compounds: (D:)

SCOP Domain Sequences for d1mtyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtyd_ a.25.1.2 (D:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus}
aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
liaqphvrgdklwtlddikrlncvfknpvkaf

SCOP Domain Coordinates for d1mtyd_:

Click to download the PDB-style file with coordinates for d1mtyd_.
(The format of our PDB-style files is described here.)

Timeline for d1mtyd_: