Lineage for d1mtyc_ (1mty C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2566Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 2567Species Methylococcus capsulatus [TaxId:414] [47255] (10 PDB entries)
  8. 2569Domain d1mtyc_: 1mty C: [16741]
    Other proteins in same PDB: d1mtyg_, d1mtyh_

Details for d1mtyc_

PDB Entry: 1mty (more details), 1.7 Å

PDB Description: methane monooxygenase hydroxylase from methylococcus capsulatus (bath)
PDB Compounds: (C:)

SCOP Domain Sequences for d1mtyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtyc_ a.25.1.2 (C:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
gysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
dyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1mtyc_:

Click to download the PDB-style file with coordinates for d1mtyc_.
(The format of our PDB-style files is described here.)

Timeline for d1mtyc_: