SCOPe 2.04: Domain d2q3ab_: 2q3a B:

Lineage for d2q3ab_ (2q3a B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Macaca mulatta [TaxId:9541] [188468] (1 PDB entry)

8. Domain d2q3ab_: 2q3a B: [167405]
   automated match to d1akjd_

Details for d2q3ab_

PDB Entry: 2q3a, 2.2 Å

PDB Description: Crystal Structure of Rhesus Macaque CD8 Alpha-Alpha Homodimer

PDB Compounds: (B:) cd8

SCOPe Domain Sequences for d2q3ab_:

Sequence; same for both SEQRES and ATOM records:

>d2q3ab_ b.1.1.1 (B:) automated matches {Macaca mulatta [TaxId: 9541]}
nqfrvsplgrtwnlgetvelkcqvllsnptsgcswlfqprgtaarptfllylsqnkpkaa
egldtqrfsgkrlgdtfvltlrdfrqenegyyfcsalsnsimyfshfvpvflpa

Timeline for d2q3ab_:

• d2q3ab_ first appeared in SCOPe 2.01
  
• d2q3ab_ appears in SCOPe 2.03
  
• d2q3ab_ appears in SCOPe 2.05
  
• d2q3ab_ appears in the current release, SCOPe 2.08