Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Macaca mulatta [TaxId:9541] [188468] (1 PDB entry) |
Domain d2q3ab_: 2q3a B: [167405] automated match to d1akjd_ |
PDB Entry: 2q3a (more details), 2.2 Å
SCOPe Domain Sequences for d2q3ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3ab_ b.1.1.1 (B:) automated matches {Macaca mulatta [TaxId: 9541]} nqfrvsplgrtwnlgetvelkcqvllsnptsgcswlfqprgtaarptfllylsqnkpkaa egldtqrfsgkrlgdtfvltlrdfrqenegyyfcsalsnsimyfshfvpvflpa
Timeline for d2q3ab_: