Lineage for d1mtyb_ (1mty B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085170Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1085255Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1085256Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1085257Domain d1mtyb_: 1mty B: [16740]
    Other proteins in same PDB: d1mtyd_, d1mtye_, d1mtyg_, d1mtyh_
    complexed with fe

Details for d1mtyb_

PDB Entry: 1mty (more details), 1.7 Å

PDB Description: methane monooxygenase hydroxylase from methylococcus capsulatus (bath)
PDB Compounds: (B:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mtyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
gysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
dyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1mtyb_:

Click to download the PDB-style file with coordinates for d1mtyb_.
(The format of our PDB-style files is described here.)

Timeline for d1mtyb_: