SCOPe 2.06: Domain d2q2la_: 2q2l A:

Lineage for d2q2la_ (2q2l A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (10 species)
   not a true protein

7. Species Potentilla atrosanguinea [TaxId:487759] [188394] (1 PDB entry)

8. Domain d2q2la_: 2q2l A: [167399]
   automated match to d1srda_
   complexed with iod, zn

Details for d2q2la_

PDB Entry: 2q2l, 2.37 Å

PDB Description: Crystal Structure of Superoxide Dismutase from P. atrosanguina

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d2q2la_:

Sequence; same for both SEQRES and ATOM records:

>d2q2la_ b.1.8.1 (A:) automated matches {Potentilla atrosanguinea [TaxId: 487759]}
makgvavlsssegvagtilftqegdgpttvtgnisglkpglhgfhvhalgdttngcmstg
phfnpagkehgspedetrhagdlgnitvgddgtacftivdkqipltgphsiigravvvha
dpddlgkgghelskstgnaggriacgiiglqg

Timeline for d2q2la_:

• d2q2la_ first appeared in SCOPe 2.01
  
• d2q2la_ appears in SCOPe 2.05
  
• d2q2la_ appears in SCOPe 2.07
  
• d2q2la_ appears in the current release, SCOPe 2.08