Lineage for d2q1ed_ (2q1e D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743313Domain d2q1ed_: 2q1e D: [167392]
    automated match to d1b0wa_
    complexed with so4

Details for d2q1ed_

PDB Entry: 2q1e (more details), 2.55 Å

PDB Description: altered dimer interface decreases stability in an amyloidogenic kappa1 bence jones protein.
PDB Compounds: (D:) Amyloidogenic immunoglobulin light chain protein AL-09

SCOPe Domain Sequences for d2q1ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q1ed_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik

SCOPe Domain Coordinates for d2q1ed_:

Click to download the PDB-style file with coordinates for d2q1ed_.
(The format of our PDB-style files is described here.)

Timeline for d2q1ed_: