SCOPe 2.03: Domain d2q1eb_: 2q1e B:

Lineage for d2q1eb_ (2q1e B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)

8. Domain d2q1eb_: 2q1e B: [167390]
   automated match to d1b0wa_
   complexed with so4

Details for d2q1eb_

PDB Entry: 2q1e, 2.55 Å

PDB Description: altered dimer interface decreases stability in an amyloidogenic kappa1 bence jones protein.

PDB Compounds: (B:) Amyloidogenic immunoglobulin light chain protein AL-09

SCOPe Domain Sequences for d2q1eb_:

Sequence; same for both SEQRES and ATOM records:

>d2q1eb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik

Timeline for d2q1eb_:

• d2q1eb_ first appeared in SCOPe 2.01
  
• d2q1eb_ appears in SCOPe 2.02
  
• d2q1eb_ appears in SCOPe 2.04
  
• d2q1eb_ appears in the current release, SCOPe 2.08