Lineage for d1qghl_ (1qgh L:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536144Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 536298Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)
  8. 536310Domain d1qghl_: 1qgh L: [16739]

Details for d1qghl_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghl_ a.25.1.1 (L:) Dodecameric ferritin homolog {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d1qghl_:

Click to download the PDB-style file with coordinates for d1qghl_.
(The format of our PDB-style files is described here.)

Timeline for d1qghl_: