SCOPe 2.06: Domain d2q0na_: 2q0n A:

Lineage for d2q0na_ (2q0n A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)

8. Domain d2q0na_: 2q0n A: [167383]
   automated match to d1f3mc_
   complexed with edo, so4

Details for d2q0na_

PDB Entry: 2q0n, 1.75 Å

PDB Description: structure of human p21 activating kinase 4 (pak4) in complex with a consensus peptide

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d2q0na_:

Sequence; same for both SEQRES and ATOM records:

>d2q0na_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvsheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkq
qrrellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqi
aavclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvg
tpywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlkn
lhkvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnrtr

Timeline for d2q0na_:

• d2q0na_ first appeared in SCOPe 2.01
  
• d2q0na_ appears in SCOPe 2.05
  
• d2q0na_ appears in SCOPe 2.07
  
• d2q0na_ appears in the current release, SCOPe 2.08