Lineage for d2pywa_ (2pyw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2987381Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (26 PDB entries)
  8. 2987388Domain d2pywa_: 2pyw A: [167349]
    automated match to d2puia1
    complexed with adp, cl, edo, mg, sr1

Details for d2pywa_

PDB Entry: 2pyw (more details), 1.9 Å

PDB Description: structure of a. thaliana 5-methylthioribose kinase in complex with adp and mtr
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2pywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pywa_ d.144.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
feeftplnekslvdyikstpalsskigadksdddlvikevgdgnlnfvfivvgssgslvi
kqalpyircigeswpmtkerayfeattlrkhgnlspdhvpevyhfdrtmaligmrylepp
hiilrkgliagieypfladhmsdymaktlfftsllyhdttehrravtefcgnvelcrlte
qvvfsdpyrvstfnrwtspyldddakavredsalkleiaelksmfceraqalihgdlhtg
svmvtqdstqvidpefsfygpmgfdigaylgnlilaffaqdghatqendrkeykqwilrt
ieqtwnlfnkrfialwdqnkdgpgeayladiynntevlkfvqenymrnllhdslgfgaak
mirrivgvahvedfesieedkrraicersalefakmllkerrkfksigevvsaiqqq

SCOPe Domain Coordinates for d2pywa_:

Click to download the PDB-style file with coordinates for d2pywa_.
(The format of our PDB-style files is described here.)

Timeline for d2pywa_: