Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (26 PDB entries) |
Domain d2pywa_: 2pyw A: [167349] automated match to d2puia1 complexed with adp, cl, edo, mg, sr1 |
PDB Entry: 2pyw (more details), 1.9 Å
SCOPe Domain Sequences for d2pywa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pywa_ d.144.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} feeftplnekslvdyikstpalsskigadksdddlvikevgdgnlnfvfivvgssgslvi kqalpyircigeswpmtkerayfeattlrkhgnlspdhvpevyhfdrtmaligmrylepp hiilrkgliagieypfladhmsdymaktlfftsllyhdttehrravtefcgnvelcrlte qvvfsdpyrvstfnrwtspyldddakavredsalkleiaelksmfceraqalihgdlhtg svmvtqdstqvidpefsfygpmgfdigaylgnlilaffaqdghatqendrkeykqwilrt ieqtwnlfnkrfialwdqnkdgpgeayladiynntevlkfvqenymrnllhdslgfgaak mirrivgvahvedfesieedkrraicersalefakmllkerrkfksigevvsaiqqq
Timeline for d2pywa_: