Lineage for d2pybc_ (2pyb C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1989902Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1990096Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188558] (1 PDB entry)
  8. 1990099Domain d2pybc_: 2pyb C: [167340]
    automated match to d1n1qa_
    complexed with fe

Details for d2pybc_

PDB Entry: 2pyb (more details), 2.6 Å

PDB Description: napa protein from borrelia burgdorferi
PDB Compounds: (C:) Neutrophil activating protein

SCOPe Domain Sequences for d2pybc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pybc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
gdygtanimddimsdlekhlwmhkallencd

SCOPe Domain Coordinates for d2pybc_:

Click to download the PDB-style file with coordinates for d2pybc_.
(The format of our PDB-style files is described here.)

Timeline for d2pybc_: