Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (14 species) |
Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries) |
Domain d1qghg_: 1qgh G: [16734] complexed with fe |
PDB Entry: 1qgh (more details), 2.35 Å
SCOPe Domain Sequences for d1qghg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qghg_ a.25.1.1 (G:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]} vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd vtndmliafkasidkhiwmfkaflgkaple
Timeline for d1qghg_: