Lineage for d2pybb_ (2pyb B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084505Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1084693Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188558] (1 PDB entry)
  8. 1084695Domain d2pybb_: 2pyb B: [167339]
    automated match to d1n1qa_
    complexed with fe

Details for d2pybb_

PDB Entry: 2pyb (more details), 2.6 Å

PDB Description: napa protein from borrelia burgdorferi
PDB Compounds: (B:) Neutrophil activating protein

SCOPe Domain Sequences for d2pybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pybb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
gdygtanimddimsdlekhlwmhkallencd

SCOPe Domain Coordinates for d2pybb_:

Click to download the PDB-style file with coordinates for d2pybb_.
(The format of our PDB-style files is described here.)

Timeline for d2pybb_: