SCOPe 2.01: Domain d2pybb_: 2pyb B:

Lineage for d2pybb_ (2pyb B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188558] (1 PDB entry)

8. Domain d2pybb_: 2pyb B: [167339]
   automated match to d1n1qa_
   complexed with fe

Details for d2pybb_

PDB Entry: 2pyb, 2.6 Å

PDB Description: napa protein from borrelia burgdorferi

PDB Compounds: (B:) Neutrophil activating protein

SCOPe Domain Sequences for d2pybb_:

Sequence; same for both SEQRES and ATOM records:

>d2pybb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
gdygtanimddimsdlekhlwmhkallencd

Timeline for d2pybb_:

• d2pybb_ is new in SCOPe 2.01-stable
  
• d2pybb_ appears in SCOPe 2.02
  
• d2pybb_ appears in the current release, SCOPe 2.08