Lineage for d2py2f_ (2py2 F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682783Species Clupea harengus [TaxId:7950] [187340] (1 PDB entry)
  8. 1682789Domain d2py2f_: 2py2 F: [167336]
    automated match to d2afpa_
    complexed with ca

Details for d2py2f_

PDB Entry: 2py2 (more details), 1.7 Å

PDB Description: Structure of Herring Type II Antifreeze Protein
PDB Compounds: (F:) Antifreeze protein type II

SCOPe Domain Sequences for d2py2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2py2f_ d.169.1.0 (F:) automated matches {Clupea harengus [TaxId: 7950]}
cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw
iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss
icakplk

SCOPe Domain Coordinates for d2py2f_:

Click to download the PDB-style file with coordinates for d2py2f_.
(The format of our PDB-style files is described here.)

Timeline for d2py2f_: