SCOP 1.57: Domain d1qghf_: 1qgh F:

Lineage for d1qghf_ (1qgh F:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Dodecameric ferritin homolog DPS [47250] (2 species)

7. Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)

8. Domain d1qghf_: 1qgh F: [16733]

Details for d1qghf_

PDB Entry: 1qgh, 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghf_:

Sequence; same for both SEQRES and ATOM records:

>d1qghf_ a.25.1.1 (F:) Dodecameric ferritin homolog DPS {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

Timeline for d1qghf_:

• d1qghf_ first appeared (with stable ids) in SCOP 1.55
  
• d1qghf_ appears in SCOP 1.59
  
• d1qghf_ appears in the current release, SCOPe 2.08