SCOPe 2.08: Domain d2px8a_: 2px8 A:

Lineage for d2px8a_ (2px8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)

6. Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
   structurally and functionally similar to VP39

7. Species Murray valley encephalitis virus (strain mve-1-51) [TaxId:301478] [187362] (6 PDB entries)

8. Domain d2px8a_: 2px8 A: [167324]
   automated match to d1r6aa_
   complexed with 3po, cl, gol, mgt, sah

Details for d2px8a_

PDB Entry: 2px8, 2.2 Å

PDB Description: Crystal structure of the Murray Valley Encephalitis Virus NS5 2'-O Methyltransferase domain in complex with SAH and 7M-GTP

PDB Compounds: (A:) Genome polyprotein [Contains: Capsid protein C (Core protein); Envelope protein M (Matrix protein); Major envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Flavivirin protease NS3 catalytic subunit; Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5)]

SCOPe Domain Sequences for d2px8a_:

Sequence; same for both SEQRES and ATOM records:

>d2px8a_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Murray valley encephalitis virus (strain mve-1-51) [TaxId: 301478]}
ggrtlgeqwkeklnamgkeeffsyrkeailevdrtearrarregnkvgghpvsrgtaklr
wlverrfvqpigkvvdlgcgrggwsyyaatmknvqevrgytkggpgheepmlmqsygwni
vtmksgvdvfykpseisdtllcdigesspsaeieeqrtlrilemvsdwlsrgpkefciki
lcpympkviekleslqrrfggglvrvplsrnsnhemywvsgasgnivhavnmtsqvligr
mdkkiwkgpkyeedvnlgsgtrav

Timeline for d2px8a_:

• d2px8a_ first appeared in SCOPe 2.01
  
• d2px8a_ appears in SCOPe 2.07