Lineage for d2pwpc_ (2pwp C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176809Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1176810Protein automated matches [190689] (23 species)
    not a true protein
  7. 1176885Species Plasmodium falciparum [TaxId:36329] [187826] (7 PDB entries)
  8. 1176900Domain d2pwpc_: 2pwp C: [167316]
    automated match to d1xj5a_
    complexed with gol, so4, spd

Details for d2pwpc_

PDB Entry: 2pwp (more details), 2.1 Å

PDB Description: Crystal structure of spermidine synthase from Plasmodium falciparum in complex with spermidine
PDB Compounds: (C:) spermidine synthase

SCOPe Domain Sequences for d2pwpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwpc_ c.66.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

SCOPe Domain Coordinates for d2pwpc_:

Click to download the PDB-style file with coordinates for d2pwpc_.
(The format of our PDB-style files is described here.)

Timeline for d2pwpc_: