Lineage for d1qghc_ (1qgh C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 353828Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 353960Protein Dodecameric ferritin homolog [47250] (9 species)
  7. 354098Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)
  8. 354101Domain d1qghc_: 1qgh C: [16730]

Details for d1qghc_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d1qghc_:

Click to download the PDB-style file with coordinates for d1qghc_.
(The format of our PDB-style files is described here.)

Timeline for d1qghc_: