Lineage for d1qghc_ (1qgh C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151501Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 151583Protein Dodecameric ferritin homolog [47250] (4 species)
  7. 151607Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)
  8. 151610Domain d1qghc_: 1qgh C: [16730]

Details for d1qghc_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d1qghc_:

Click to download the PDB-style file with coordinates for d1qghc_.
(The format of our PDB-style files is described here.)

Timeline for d1qghc_: