Lineage for d2pvxf_ (2pvx F:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263119Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2263128Protein Rubredoxin [57804] (8 species)
  7. 2263189Species Pyrococcus furiosus [TaxId:2261] [57809] (28 PDB entries)
    Uniprot P24297
  8. 2263199Domain d2pvxf_: 2pvx F: [167294]
    automated match to d1bq8a_
    complexed with zn

Details for d2pvxf_

PDB Entry: 2pvx (more details), 1.04 Å

PDB Description: NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of Rubredoxin
PDB Compounds: (F:) rubredoxin

SCOPe Domain Sequences for d2pvxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvxf_ g.41.5.1 (F:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled

SCOPe Domain Coordinates for d2pvxf_:

Click to download the PDB-style file with coordinates for d2pvxf_.
(The format of our PDB-style files is described here.)

Timeline for d2pvxf_: