Lineage for d2pvxd_ (2pvx D:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066161Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1066170Protein Rubredoxin [57804] (8 species)
  7. 1066230Species Pyrococcus furiosus [TaxId:2261] [57809] (20 PDB entries)
    Uniprot P24297
  8. 1066235Domain d2pvxd_: 2pvx D: [167292]
    automated match to d1bq8a_
    complexed with zn

Details for d2pvxd_

PDB Entry: 2pvx (more details), 1.04 Å

PDB Description: NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of Rubredoxin
PDB Compounds: (D:) rubredoxin

SCOPe Domain Sequences for d2pvxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvxd_ g.41.5.1 (D:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled

SCOPe Domain Coordinates for d2pvxd_:

Click to download the PDB-style file with coordinates for d2pvxd_.
(The format of our PDB-style files is described here.)

Timeline for d2pvxd_: