Lineage for d2pvxc_ (2pvx C:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587652Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2587661Protein Rubredoxin [57804] (8 species)
  7. 2587722Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
    Uniprot P24297
  8. 2587728Domain d2pvxc_: 2pvx C: [167291]
    automated match to d1bq8a_
    complexed with zn

Details for d2pvxc_

PDB Entry: 2pvx (more details), 1.04 Å

PDB Description: NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of Rubredoxin
PDB Compounds: (C:) rubredoxin

SCOPe Domain Sequences for d2pvxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvxc_ g.41.5.1 (C:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled

SCOPe Domain Coordinates for d2pvxc_:

Click to download the PDB-style file with coordinates for d2pvxc_.
(The format of our PDB-style files is described here.)

Timeline for d2pvxc_: