SCOPe 2.06: Domain d2pvgc_: 2pvg C:

Lineage for d2pvgc_ (2pvg C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Synechocystis sp. [TaxId:1111708] [277072] (2 PDB entries)

8. Domain d2pvgc_: 2pvg C: [167287]
   Other proteins in same PDB: d2pvga1, d2pvga2, d2pvgb_
   automated match to d1doxa_
   complexed with fes, sf4

Details for d2pvgc_

PDB Entry: 2pvg, 2.4 Å

PDB Description: crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase

PDB Compounds: (C:) Ferredoxin-1

SCOPe Domain Sequences for d2pvgc_:

Sequence; same for both SEQRES and ATOM records:

>d2pvgc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Synechocystis sp. [TaxId: 1111708]}
asytvklitpdgessiecsddtyildaaeeaglelpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly

Timeline for d2pvgc_:

• d2pvgc_ first appeared in SCOPe 2.01
  
• d2pvgc_ appears in SCOPe 2.05
  
• d2pvgc_ appears in SCOPe 2.07
  
• d2pvgc_ appears in the current release, SCOPe 2.08