Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (19 species) |
Species Synechocystis sp. [TaxId:1111708] [277072] (2 PDB entries) |
Domain d2pvgc_: 2pvg C: [167287] Other proteins in same PDB: d2pvga1, d2pvga2, d2pvgb_ automated match to d1doxa_ complexed with fes, sf4 |
PDB Entry: 2pvg (more details), 2.4 Å
SCOPe Domain Sequences for d2pvgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvgc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Synechocystis sp. [TaxId: 1111708]} asytvklitpdgessiecsddtyildaaeeaglelpyscragacstcagkitagsvdqsd qsfldddqieagyvltcvayptsdctiethkeedly
Timeline for d2pvgc_: