Lineage for d2pqsb_ (2pqs B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530952Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1530953Protein automated matches [190770] (24 species)
    not a true protein
  7. 1531004Species Cow (Bos taurus) [TaxId:9913] [187995] (2 PDB entries)
  8. 1531007Domain d2pqsb_: 2pqs B: [167247]
    automated match to d1czsa_

Details for d2pqsb_

PDB Entry: 2pqs (more details), 2.4 Å

PDB Description: Crystal Structure of the Bovine Lactadherin C2 Domain
PDB Compounds: (B:) Lactadherin

SCOPe Domain Sequences for d2pqsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqsb_ b.18.1.0 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vcteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasew
lqidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnm
dnnshkknifetpfqarfvriqpvawhnritlrvellgc

SCOPe Domain Coordinates for d2pqsb_:

Click to download the PDB-style file with coordinates for d2pqsb_.
(The format of our PDB-style files is described here.)

Timeline for d2pqsb_: