Lineage for d2pq0b_ (2pq0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920483Species Geobacillus kaustophilus [TaxId:235909] [188431] (1 PDB entry)
  8. 2920485Domain d2pq0b_: 2pq0 B: [167240]
    automated match to d1ymqa1

Details for d2pq0b_

PDB Entry: 2pq0 (more details), 2.6 Å

PDB Description: Crystal structure of Hyopthetical protein (gk_1056) from geobacillus Kaustophilus HTA426
PDB Compounds: (B:) Hypothetical conserved protein GK1056

SCOPe Domain Sequences for d2pq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pq0b_ c.108.1.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
pvdkegiwyglkqlqli

SCOPe Domain Coordinates for d2pq0b_:

Click to download the PDB-style file with coordinates for d2pq0b_.
(The format of our PDB-style files is described here.)

Timeline for d2pq0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pq0a_