Lineage for d1dpsh_ (1dps H:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46714Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 46791Protein Dodecameric ferritin homolog DPS [47250] (2 species)
  7. 46792Species Escherichia coli [TaxId:562] [47251] (1 PDB entry)
  8. 46800Domain d1dpsh_: 1dps H: [16723]

Details for d1dpsh_

PDB Entry: 1dps (more details), 1.6 Å

PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna

SCOP Domain Sequences for d1dpsh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpsh_ a.25.1.1 (H:) Dodecameric ferritin homolog DPS {Escherichia coli}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnie

SCOP Domain Coordinates for d1dpsh_:

Click to download the PDB-style file with coordinates for d1dpsh_.
(The format of our PDB-style files is described here.)

Timeline for d1dpsh_: