Lineage for d2plwa_ (2plw A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176809Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1176810Protein automated matches [190689] (23 species)
    not a true protein
  7. 1176885Species Plasmodium falciparum [TaxId:36329] [187826] (7 PDB entries)
  8. 1176889Domain d2plwa_: 2plw A: [167210]
    automated match to d1eiza_
    complexed with sam, so4

Details for d2plwa_

PDB Entry: 2plw (more details), 1.7 Å

PDB Description: crystal structure of a ribosomal rna methyltransferase, putative, from plasmodium falciparum (pf13_0052).
PDB Compounds: (A:) Ribosomal RNA methyltransferase, putative

SCOPe Domain Sequences for d2plwa_:

Sequence, based on SEQRES records: (download)

>d2plwa_ c.66.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
yrsraayklieldnkylflkknkiildigcypgswcqvilertknyknkiigidkkimdp
ipnvyfiqgeigkdnmnnikninyidnmnnnsvdyklkeilqdkkidiilsdaavpcign
kiddhlnsceltlsithfmeqyiniggtyivkmylgsqtnnlktylkgmfqlvhttkpka
srnesreiylvcknflgr

Sequence, based on observed residues (ATOM records): (download)

>d2plwa_ c.66.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
yrsraayklieldnkylflkknkiildigcypgswcqvilertknyknkiigidkkimdp
ipnvyfiqgeigkdnmnninsvdyklkeilqdkkidiilsdaavpcignkiddhlnscel
tlsithfmeqyiniggtyivkmylgsqtnnlktylkgmfqlvhttkpksreiylvcknfl
gr

SCOPe Domain Coordinates for d2plwa_:

Click to download the PDB-style file with coordinates for d2plwa_.
(The format of our PDB-style files is described here.)

Timeline for d2plwa_: