SCOPe 2.03: Domain d2pija_: 2pij A:

Lineage for d2pija_ (2pij A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (3 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [188360] (1 PDB entry)

8. Domain d2pija_: 2pij A: [167196]
   automated match to d1copd_
   complexed with bct, dtt, so4

Details for d2pija_

PDB Entry: 2pij, 1.7 Å

PDB Description: structure of the cro protein from prophage pfl 6 in pseudomonas fluorescens pf-5

PDB Compounds: (A:) Prophage Pfl 6 Cro

SCOPe Domain Sequences for d2pija_:

Sequence; same for both SEQRES and ATOM records:

>d2pija_ a.35.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
mkkiplskyleehgtqsalaaalgvnqsaisqmvragrsieitlyedgrveaneirpip

Timeline for d2pija_:

• d2pija_ first appeared in SCOPe 2.01
  
• d2pija_ appears in SCOPe 2.02
  
• d2pija_ appears in SCOPe 2.04
  
• d2pija_ appears in the current release, SCOPe 2.08