Lineage for d1dpsd_ (1dps D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212185Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 212268Protein Dodecameric ferritin homolog [47250] (5 species)
  7. 212279Species Escherichia coli, Dps [TaxId:562] [47251] (1 PDB entry)
    ferritin homolog that binds to and protects DNA
  8. 212283Domain d1dpsd_: 1dps D: [16719]

Details for d1dpsd_

PDB Entry: 1dps (more details), 1.6 Å

PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna

SCOP Domain Sequences for d1dpsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpsd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Escherichia coli, Dps}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiecnie

SCOP Domain Coordinates for d1dpsd_:

Click to download the PDB-style file with coordinates for d1dpsd_.
(The format of our PDB-style files is described here.)

Timeline for d1dpsd_: