Lineage for d1dpsb_ (1dps B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279618Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 279750Protein Dodecameric ferritin homolog [47250] (7 species)
  7. 279773Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 279775Domain d1dpsb_: 1dps B: [16717]

Details for d1dpsb_

PDB Entry: 1dps (more details), 1.6 Å

PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna

SCOP Domain Sequences for d1dpsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpsb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Escherichia coli, Dps}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnie

SCOP Domain Coordinates for d1dpsb_:

Click to download the PDB-style file with coordinates for d1dpsb_.
(The format of our PDB-style files is described here.)

Timeline for d1dpsb_: