Class a: All alpha proteins [46456] (290 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins) |
Protein automated matches [190147] (10 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [187987] (1 PDB entry) |
Domain d2pfma_: 2pfm A: [167167] automated match to d1f1oa_ complexed with mli |
PDB Entry: 2pfm (more details), 2 Å
SCOPe Domain Sequences for d2pfma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pfma_ a.127.1.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} isrytrpemgaiwteenkfkawleveilaceawaelgdipkedvkkirehasfdidriye ieketrhdvvaftravsetpalgeerkwvhygltstdvvdtalsyilkqaneiilkdlen fvsilankakehkytimmgrthgvhaepttfglklglwyeemkrnverfkqaantvrvgk lsgavgtyanidpfvekyvcenlgleaapistqtlqrdrhahymstlaliatsiekmave irglqksetreveeafakgqkgssamphkrnpigsenmtglarvirgymmtayenvplwh erdishssaervilpdatialnymlnrfgnivknltvypenmkrnmtrtygliysqrvml tlidkgmvreeaydivqpkameawetqvqfkelveaderitskltqeeinecfnyehhmq hvdtiferlglnea
Timeline for d2pfma_: