Lineage for d2pcjb_ (2pcj B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366126Species Aquifex aeolicus [TaxId:224324] [188217] (3 PDB entries)
  8. 1366128Domain d2pcjb_: 2pcj B: [167128]
    automated match to d1f3oa_
    complexed with so3

Details for d2pcjb_

PDB Entry: 2pcj (more details), 1.7 Å

PDB Description: Crystal structure of ABC transporter (aq_297) From Aquifex Aeolicus VF5
PDB Compounds: (B:) Lipoprotein-releasing system ATP-binding protein lolD

SCOPe Domain Sequences for d2pcjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcjb_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
aeilraenikkvirgyeilkgislsvkkgefvsiigasgsgkstllyilglldaptegkv
flegkevdytnekelsllrnrklgfvfqfhylipeltalenvivpmlkmgkpkkeakerg
eyllselglgdklsrkpyelsggeqqrvaiaralanepillfadeptgnldsantkrvmd
iflkineggtsivmvtherelaelthrtlemkdgkvvgeitrv

SCOPe Domain Coordinates for d2pcjb_:

Click to download the PDB-style file with coordinates for d2pcjb_.
(The format of our PDB-style files is described here.)

Timeline for d2pcjb_: