Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (20 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188217] (2 PDB entries) |
Domain d2pcja_: 2pcj A: [167127] automated match to d1f3oa_ complexed with so3 |
PDB Entry: 2pcj (more details), 1.7 Å
SCOPe Domain Sequences for d2pcja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcja_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} aeilraenikkvirgyeilkgislsvkkgefvsiigasgsgkstllyilglldaptegkv flegkevdytnekelsllrnrklgfvfqfhylipeltalenvivpmlkmgkpkkeakerg eyllselglgdklsrkpyelsggeqqrvaiaralanepillfadeptgnldsantkrvmd iflkineggtsivmvtherelaelthrtlemkdgkvvgeitrv
Timeline for d2pcja_: