SCOPe 2.04: Domain d2pboa_: 2pbo A:

Lineage for d2pboa_ (2pbo A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (20 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [188406] (6 PDB entries)

8. Domain d2pboa_: 2pbo A: [167113]
   automated match to d1cz1a_
   mutant

Details for d2pboa_

PDB Entry: 2pbo, 1.85 Å

PDB Description: e27q mutant of exo-b-(1,3)-glucanase from candida albicans at 1.85 a

PDB Compounds: (A:) Hypothetical protein XOG1

SCOPe Domain Sequences for d2pboa_:

Sequence; same for both SEQRES and ATOM records:

>d2pboa_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlqpymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

Timeline for d2pboa_:

• d2pboa_ first appeared in SCOPe 2.01
  
• d2pboa_ appears in SCOPe 2.03
  
• d2pboa_ appears in SCOPe 2.05
  
• d2pboa_ appears in the current release, SCOPe 2.08