Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
Protein automated matches [190568] (11 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188331] (2 PDB entries) |
Domain d2pbib_: 2pbi B: [167111] Other proteins in same PDB: d2pbid2 automated match to d1a0rb_ complexed with gol |
PDB Entry: 2pbi (more details), 1.95 Å
SCOPe Domain Sequences for d2pbib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbib_ b.69.4.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} netlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkghgnkvlc mdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaiacggldnk csvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwdvesgqll qsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesdvnsvryy psgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfagyndytin vwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa
Timeline for d2pbib_: