Lineage for d2pbib_ (2pbi B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809349Species Mouse (Mus musculus) [TaxId:10090] [188331] (2 PDB entries)
  8. 2809350Domain d2pbib_: 2pbi B: [167111]
    Other proteins in same PDB: d2pbid2
    automated match to d1a0rb_
    complexed with gol

Details for d2pbib_

PDB Entry: 2pbi (more details), 1.95 Å

PDB Description: the multifunctional nature of gbeta5/rgs9 revealed from its crystal structure
PDB Compounds: (B:) Guanine nucleotide-binding protein subunit beta 5

SCOPe Domain Sequences for d2pbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbib_ b.69.4.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
netlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkghgnkvlc
mdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaiacggldnk
csvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwdvesgqll
qsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesdvnsvryy
psgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfagyndytin
vwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa

SCOPe Domain Coordinates for d2pbib_:

Click to download the PDB-style file with coordinates for d2pbib_.
(The format of our PDB-style files is described here.)

Timeline for d2pbib_: